Application of cucumber lipid phosphatase cslppε2 in resistance to cucurbit blight
A phosphatase and cucumber lipid technology, which is applied in the fields of plant molecular biology and plant genetic engineering, can solve the problems such as the reports that cucumber lipid phosphatase is resistant to melon blight and the like, achieves wide application prospects and increases the area of disease spots. Effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0092] Example 1 Construction of Cucumber CsLPPε2 Gene Overexpression Vector
[0093] Cucumber CsLPPε2 gene belongs to lipophosphate phosphatase protein gene. The cucumber CsLPPε2 gene CDS full-length (SEQ ID NO.2) was constructed into pGWB5 (pGWB5 plasmid map as shown in figure 1 shown), the specific position is between attR1 and attR2 behind the 35S promoter (the ccdB gene was replaced by gene recombination exchange), and an overexpression vector (pGWB5-CsLPPε2) was obtained; Fragment (CDS 1-137bp, SEQ ID NO.4) and its complementary fragment were constructed on pK7GWIW (pK7GWIW plasmid map as figure 2 shown), the specific position is between attR1 and attR2 behind the 35S promoter (the ccdB gene was replaced by gene recombination exchange), and the gene silencing vector (pK7GWIW-CsLPPε2) was obtained.
[0094] The amino acid sequence of cucumber CsLPPε2 protein is (221aa):
[0095] MRLVGWRLYSISCVWNFVDFKLGHLGSNFVSLGVAVLFGNIVDSFQSKWLVAALFAGIILLRHDAEALWTAMGSVINAVLSIVLKRILNQ...
Embodiment 2
[0102] Example 2 Constructing a Cucumber Cotyledon Model of Transient Overexpression / Gene Silencing
[0103] (1) The overexpression vector and the silencing vector in Example 1 were respectively transformed into Agrobacterium GV3101, and cultured upside down on the corresponding resistant medium for 48 hours.
[0104] (2) Pick a single clone and add it to 4 mL of LB medium containing corresponding antibiotics and rifampicin, shake the bacteria at 180 rpm for 24 hours at 28°C.
[0105] (3) Add fresh LB medium containing corresponding antibiotics and rifampicin at a ratio of 1:100, shake the bacteria at 28°C and 180 rpm until the OD600 value is about 3.0.
[0106] (4) Centrifuge at 3000rpm for 5 minutes to collect the bacteria, and use the suspension (10mM MES, 10mM MgCl 2 ) to resuspend the cells, adjust the OD600 value to about 0.4, and add 200 mM acetosyringone.
[0107] (5) Stand at room temperature for 3 hours.
[0108] (6) Prick a needle hole on both sides of the main v...
Embodiment 3
[0121] Example 3 Cucumber cotyledon resistance experiment
[0122] For the cucumber cotyledon model with transient overexpression of CsLPPε2 successfully constructed in Example 2, the cucumber cotyledon model of CsLPPε2 gene silencing, and the wild-type cucumber cotyledon, the cucumber seedlings after injection were cultured in the dark for 12 hours and then cultured in the light at 22°C for 3 days. After being isolated and inoculated with Phytophthora cucurbitus, the cotyledons of cucumber were cultured in a culture dish at 28°C for 24 hours in the dark.
[0123] The resistance function of the target gene to the disease was judged according to the size of the lesions on the isolated cucumber cotyledons of different treatments. The results are shown in the attached Figure 5 shown.
[0124] The results showed that the transient overexpression of CsLPPε2 gene (pGWB5-CsLPPε2) in cucumber cotyledon can significantly enhance the resistance of cucumber cotyledon to blight compared...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



